PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C015731P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 255aa    MW: 29413.9 Da    PI: 4.7596
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C015731P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.7e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ eEd++l++ +++ G  +W++ +++ g+ R++k+c++rw +yl
   MELO3C015731P1 14 RGPWSFEEDQILIKFIQLNGHSNWRALPKKAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding51.91.7e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
   MELO3C015731P1  67 RGDFTHEEEQTIINLHHLLGNR-WAAIAARLP-GRTDNEIKNVWHTHL 112
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-22564IPR009057Homeodomain-like
PROSITE profilePS5129414.116961IPR017930Myb domain
SuperFamilySSF466891.16E-2811108IPR009057Homeodomain-like
SMARTSM007174.2E-131363IPR001005SANT/Myb domain
PfamPF002493.6E-141461IPR001005SANT/Myb domain
CDDcd001673.68E-91661No hitNo description
PROSITE profilePS5129425.04662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.8E-2665116IPR009057Homeodomain-like
SMARTSM007174.0E-1466114IPR001005SANT/Myb domain
PfamPF002499.8E-1667112IPR001005SANT/Myb domain
CDDcd001671.70E-970112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGPWSFE EDQILIKFIQ LNGHSNWRAL PKKAGLLRCG KSCRLRWTNY  60
LRPDIKRGDF THEEEQTIIN LHHLLGNRWA AIAARLPGRT DNEIKNVWHT HLKKRVTNQN  120
ETLKDQTKQN KNDDNNLYDQ PFCSSKIKLD IGEEDIDRCT KNNNDDKDTE LVELALAEDF  180
LNSLLSDEEF FENDWNNLGK DCAMVKDVDE SPKEVEIPLS GEEMSNCSSS DTVDIMDFWR  240
NVFMNDGELQ EINI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-26121162105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818030.0LN681803.1 Cucumis melo genomic scaffold, anchoredscaffold00026.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008451250.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0A0KAA11e-162A0A0A0KAA1_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-74myb domain protein 14